splitjoin.txt

*splitjoin.txt* 	Switch between single-line and multiline forms of code

==============================================================================
CONTENTS                                          *splitjoin* *splitjoin-contents*

    Installation...........................: |splitjoin-installation|
    Usage..................................: |splitjoin-usage|

    C......................................: |splitjoin-c|
    Clojure................................: |splitjoin-clojure|
    Coffeescript...........................: |splitjoin-coffee|
    CSS....................................: |splitjoin-css|
    CUE....................................: |splitjoin-cue|
    Elixir.................................: |splitjoin-elixir|
    Elm....................................: |splitjoin-elm|
    Eruby..................................: |splitjoin-eruby|
    FASTA..................................: |splitjoin-fasta|
    Go.....................................: |splitjoin-go|
    HAML...................................: |splitjoin-haml|
    HTML...................................: |splitjoin-html|
    Handlebars.............................: |splitjoin-handlebars|
    Hare...................................: |splitjoin-hare|
    Java...................................: |splitjoin-java|
    Javascript.............................: |splitjoin-javascript| |splitjoin-json|
    JSX/TSX................................: |splitjoin-jsx| |splitjoin-tsx|
    Lua....................................: |splitjoin-lua|
    Perl...................................: |splitjoin-perl|
    PHP....................................: |splitjoin-php|
    Python.................................: |splitjoin-python|
    R......................................: |splitjoin-r|
    Ruby...................................: |splitjoin-ruby|
    Rust...................................: |splitjoin-rust|
    SCSS/Less..............................: |splitjoin-scss| |splitjoin-less|
    Shell..................................: |splitjoin-shell|
    TeX....................................: |splitjoin-tex|
    Vimscript..............................: |splitjoin-vimscript|
    YAML...................................: |splitjoin-yaml|

    Settings...............................: |splitjoin-settings|
    Internals..............................: |splitjoin-internals|
    Issues.................................: |splitjoin-issues|


==============================================================================
INSTALLATION                                            *splitjoin-installation*

The easiest way to install the plugin is with a plugin manager:

- vim-plug: https://github.com/junegunn/vim-plug
- Vundle:   https://github.com/VundleVim/Vundle.vim

If you use one, just follow the instructions in its documentation.

You can install the plugin yourself using Vim's |packages| functionality by
cloning the project (or adding it as a submodule) under
`~/.vim/pack/<any-name>/start/`. For example:
>
    git clone https://github.com/AndrewRadev/splitjoin.vim ~/.vim/pack/_/start/splitjoin
<
This should automatically load the plugin for you on Vim start. Alternatively,
you can add it to `~/.vim/pack/<any-name>/opt/` instead and load it in your
.vimrc manually with:
>
    packadd splitjoin
<
If you'd rather not use git, you can download the files from the "releases"
tab and unzip them in the relevant directory:
https://github.com/AndrewRadev/splitjoin.vim/releases.


==============================================================================
USAGE                                                          *splitjoin-usage*

                                                               *:SplitjoinSplit*
                                                               *:SplitjoinJoin*

After the plugin is installed, the mapping `gS` will perform splitting and |gJ|
-- joining of the code under the cursor. These mappings are configurable
with |g:splitjoin_split_mapping| and |g:splitjoin_join_mapping|, respectively.
You could also use the commands |:SplitjoinSplit| and |:SplitjoinJoin|, either
directly, or in your own scripts.

Note that |gJ| is a built-in mapping that is used for joining lines while
preserving whitespace. However, if no splitting/joining is possible at this
point, the plugin will fall back to the default mapping. If you'd rather have
the splitjoin mappings be no-ops in that case, you could set the mapping
variables to empty strings, which will simply not create them at all. You can
then make your own simple mappings by using the commands:
>
    let g:splitjoin_split_mapping = ''
    let g:splitjoin_join_mapping = ''

    nmap <Leader>j :SplitjoinJoin<cr>
    nmap <Leader>s :SplitjoinSplit<cr>
<
For the record, my personal preference is to avoid mnemonics in this case and
go for an approach that makes more sense to my fingers instead:
>
    nmap sj :SplitjoinSplit<cr>
    nmap sk :SplitjoinJoin<cr>
<
Notice that I'm using "sj" for splitting, not joining. To me, "splitting" a
line results in expanding it downwards, so using "j" seems more intuitive,
likewise for "k". The "s" key is ordinarily taken (try :help s), but I don't
use it, so I've mapped it to <Nop>. Your mileage may vary.

Splitting ~

Splitting a line consists of checking for blocks of text that the plugin knows
how to split and, well, doing that. For example, if we have a ruby hash:
>
    { :one => 'two', :three => 'four' }
<
Then, with the cursor within the hash, we can split it to get:
>
    {
      :one => 'two',
      :three => 'four'
    }
<
This works for various other things, you can see some examples for each
filetype below.

If there are several different kinds of splittings that can be executed, there
is a fixed priority. For instance, this:
>
    { :one => 'two', :three => 'four' } if foo?
<
will be split into this:
>
    if foo?
      { :one => 'two', :three => 'four' }
    end
<
In this case, the plugin does not take into account where exactly the cursor
is located on the line, it just always gives priority to the if clause.

For ruby hashes in particular, the cursor position is considered, however.
Let's take this as an example:
>
    foo 1, 2, { :bar => :baz }, { :baz => :qux }
<
If the cursor is located on the first hash, the result will be:
>
    foo 1, 2, {
      :bar => :baz
    }, { :baz => :qux }
<
If it's on the second hash, or on any other part of the method call (like on
"foo"), you'll get this:
>
    foo 1, 2, { :bar => :baz }, {
      :baz => :qux
    }
<
In general, if you're trying to split a structure, try to "be inside" when you
do so. This doesn't make sense in cases like the "if" statement, but it does
for hashes.

Joining ~

Joining might impose more constraints. Take this as an example:
>
    if foo?
      bar
    end
<
In order to turn this into:
>
    bar if foo?
<
you need to place your cursor on the line with the "if" clause. If your cursor
is on the "bar" line, joining will not work. This might be considered a bug (I
find it simpler cognitively to join blocks when I'm within them), but it
simplifies the implementation and solves some ambiguity. This might be a nice
example:
>
    if foo?
      {
        :one => :two,
        :three => :four
      }
    end
<
Joining when on the line ":one => :two" would currently do nothing. However,
if we wanted to detect the type of joining we could do, we might give priority
to the if clause instead of the hash, which would not make a lot of sense. Of
course, with smart prioritization (or a change in implementation), it might be
possible to get things working sensibly, but this seems to be good enough for
now: To join the hash, be on the "{" line, to join the "if" clause (not a good
idea, mind you, doesn't do anything that makes sense), be on the "if foo?"
line.

The basic rule of thumb here is that, to join a structure, the cursor should
usually be at its beginning (the opening tag, the opening brace, etc.).

Settings ~

The plugin has many settings that implement different coding styles. It can be
made to align dictionary items, leave or remove trailing commas, and so on.
See |splitjoin-settings| for the full list.

Note that all of the settings apart from mapping ones can be set as both
global variables, and buffer-local ones. So, for instance, you could set
|g:splitjoin_align| to 0 in order to avoid aligning code in most cases, but
set |b:splitjoin_align| to 1 in your `~/.vim/ftplugin/ruby.vim` file to align
ruby code in particular. The buffer-local variables will take precedence.

Now for some examples for the filetypes that have splitjoin implementations.


==============================================================================
C                                                                  *splitjoin-c*

If clauses ~
>
    if (val1 && val2 || val3);

    if (val1
            && val2
            || val3);
<
Function calls ~
>
    myfunction(arg1, arg2, arg3, arg4);

    myfunction(arg1,
            arg2,
            arg3,
            arg4);
<
==============================================================================
CLOJURE                                                      *splitjoin-clojure*

Lists ~
>
    (map (fn [x] (.toUpperCase x)) (.split "one two three" " "))
    (map
      (fn [x] (.toUpperCase x))
      (.split "one two three" " "))

    [::namespace/function one two three]
    [::namespace/function
     one
     two
     three]

    #{:a :b :c :d}
    #{:a
      :b
      :c
      :d}
<

==============================================================================
COFFEESCRIPT                                                  *splitjoin-coffee*

Functions ~
>
    (foo, bar) -> console.log foo

    (foo, bar) ->
      console.log foo
<
If/unless/while/until clauses ~

Since it's possible to join a multiline if into either a postfix or suffix
variant, a variable controls which one it'll be,
|splitjoin_coffee_suffix_if_clause|. By default, it's 1, which joins into the
suffix format.
>
    console.log bar if foo?
    if foo? then console.log bar

    if foo?
      console.log bar
<
Ternary operator ~

Splitting takes into account the entire line. If the line starts with
assignment, it tries to squeeze in the assignment part on both lines.

Joining attempts to do the same process in reverse -- if the same variable is
being assigned to different things in both cases, that variable is moved out
in front of the if-clause. Otherwise, it just joins the if-then-else without
any magic.
>
    foo = if bar? then 'baz' else 'qux'

    if bar?
      foo = 'baz'
    else
      foo = 'qux'

    foo = if bar? then 'baz' else 'qux'
<
Object literals ~
>
    one = { one: "two", three: "four" }

    one =
      one: "two"
      three: "four"
<
Object literals in function calls ~

Only splitting works this way for now, the reverse direction falls back to the
normal object literal joining.
>
    foo = functionCall(one, two, three: four, five: six)

    foo = functionCall one, two,
      three: four
      five: six
<
Multiline strings ~

Note that strings are split only at the end of the line. This seems to be the
most common case, and the restriction avoids conflicts with other kinds of
splitting.
>
    foo = "example with #{interpolation} and \"nested\" quotes"
    foo = """
      example with #{interpolation} and "nested" quotes
    """

    bar = 'example with single quotes'
    bar = '''
      example with single quotes
    '''
<

==============================================================================
CSS                                                              *splitjoin-css*

These also work for SCSS and LESS -- see |splitjoin-scss|, |splitjoin-less|.

Style definitions ~
>
    a { color: #0000FF; text-decoration: underline; }

    a {
      color: #0000FF;
      text-decoration: underline;
    }

Multiline selectors ~
>
    h1,
    h2,
    h3 {
      font-size: 18px;
      font-weight: bold;
    }

    h1, h2, h3 {
      font-size: 18px;
      font-weight: bold;
    }
<

==============================================================================
CUE                                                              *splitjoin-cue*

CUE Structs are JSON objects but with a cleaner syntax. Lists and Function
arguments behave like JSON's.
See |splitjoin-json|.

Structs ~

Structs are first class, so the cursor can precede the first curly brace.
>
    a: foo: { x: bar: baz: bool, y: bar: baz: int, z: bar: baz: string }

    a: foo: {
        x: bar: baz: bool
        y: bar: baz: int
        z: bar: baz: string
    }
<
Lists ~

The same applies to lists.
>
    foo: [ 'x:y:z', "\xFFFF0000", a.foo.y ]

    foo: [
        'x:y:z',
        "\xFFFF0000",
        a.foo.y
    ]
<
Function Arguments ~

Function splitting requires the cursor to be positioned inside the
parenthesis, preferably near the closing one.
>
    bar: m.Baz(foo[2].bar.baz, 42, true)

    bar: m.Baz(
        foo[2].bar.baz,
        42,
        true
    )
<


==============================================================================
ELIXIR                                                        *splitjoin-elixir*

Do-blocks ~
>
    def function(arguments) when condition, do: body
    def function(arguments) when condition do
      body
    end

    let :one, do: two() |> three(four())
    let :one do
      two() |> three(four())
    end

    if(foo, do: bar, else: baz)
    if foo do
      bar
    else
      baz
    end
<
Comma-separated method calls (join only): ~
>
    for a <- 1..10,
      Integer.is_odd(a) do
      a
    end

    for a <- 1..10, Integer.is_odd(a) do
      a
    end
<
Pipelines: ~
>
    String.length("splitjoin")

    "splitjoin"
    |> String.length()
<
This doesn't currently work properly for multi-line arguments:
>
    String.length(
      Enum.join([
        "split",
        "join"
      ])
    )

    if true do
      "splitjoin"
    end
    |> String.length()
<

==============================================================================
ELM                                                              *splitjoin-elm*

Lists, tuples, records ~
>
    myUpdatedRecord =
        {myPreviousRecord | firstName = "John", lastName = "Doe"}

    myUpdatedRecord =
        { myPreviousRecord
        | firstName = "John"
        , lastName = "Doe"
        }
<

==============================================================================
ERUBY                                                          *splitjoin-eruby*

Tags ~
>
    <div class="foo">bar</div>

    <div class="foo">
      bar
    </div>
<
If/unless clauses ~
>
    <%= foo if bar? %>

    <% if bar? %>
      <%= foo %>
    <% end %>
<
Hashes ~
>
    <% foo = { :bar => 'baz', :one => :two, :five => 'six' } %>

    <% foo = {
      :bar => 'baz',
      :one => :two,
      :five => 'six'
    } %>
<
Option hashes ~
>
    <%= link_to 'Google', 'http://google.com', :class => 'google', :id => 'google-link' %>

    <%= link_to 'Google', 'http://google.com', {
      :class => 'google',
      :id => 'google-link'
    } %>
<

==============================================================================
FASTA                                                          *splitjoin-fasta*

Sequences ~
>
    > E.coli_K12 Cysteine--tRNA ligase
    MLKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLRFLGYKLKYVRNITDIDDK...

    > E.coli_K12 Cysteine--tRNA ligase
    MLKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLRFLGYK
    LKYVRNITDIDDKIIKRANENGESFVAMVDRMIAEMHKDFDALNILRPDMEPRATHHIAE
    ...
<

==============================================================================
GO                                                                *splitjoin-go*

Imports ~
>
    import "fmt"

    import (
        "fmt"
    )
<
Var/const ~
>
    var foo string

    var (
        foo string
    )
<
Structs ~
>
    StructType{one: 1, two: "asdf", three: []int{1, 2, 3}}

    StructType{
        one: 1,
        two: "asdf",
        three: []int{1, 2, 3},
    }
<

==============================================================================
HAML                                                            *splitjoin-haml*

Evaluated ruby ~
>
    %div= 1 + 2

    %div
      = 1 + 2
<

==============================================================================
HANDLEBARS                                                *splitjoin-handlebars*

Components ~
>
    {{some/component-name foo=bar bar=baz}}

    {{some/component-name
      foo=bar
      bar=baz
    }}
<
Block components ~
>
    {{#component-name foo=bar}}Some content{{/component-name}}

    {{#component-name foo=bar}}
      Some contents
    {{/component-name}}
<

==============================================================================
HARE                                                            *splitjoin-hare*

Structs ~
>
    struct { source: str, line: 1 };

    struct {
        source: str,
        line: 1,
    };
<
Function definitions, calls, and arrays ~
>
    fn function_def(values: []u8, s: str) void = {};
    fn function_def(
        values: []u8,
        s: str,
    ) void = {};

    function_call(values: []u8, s: str);
    function_call(
        values: []u8,
        s: str,
    );

    let x = [1, 2, 3];
    let x = [
        1,
        2,
        3,
    ];
<
Question mark operator ~
>
    const num = getnumber()?;

    const num = match (getnumber()) {
    case error => abort();
    case let t: type =>
        yield t;
    };
<
Note that, at the moment, only splitting question marks is supported, joining
an appropriate match expression into a question-mark operator is not.


==============================================================================
HTML                                                            *splitjoin-html*

This works for other HTML-like languages as well: XML, Eruby, JSX, TSX, Vue
templates, Svelte.js, Django templates.

Tags ~
>
    <div class="foo">bar</div>

    <div class="foo">
      bar
    </div>
<
Attributes ~
>
    <button class="foo bar" ng-click="click()" ng-class="{ clicked: clicked }">
      Click me!
    </button>

    <button
      class="foo bar"
      ng-click="click()"
      ng-class="{ clicked: clicked }">
      Click me!
    </button>
<

==============================================================================
JAVA                                                            *splitjoin-java*

If-clause bodies ~
>
    if (isTrue())
      doSomething();

    if (isTrue()) doSomething();

    if (isTrue()) {
      doSomething();
    }

    if (isTrue()) { doSomething(); }
<
If-clause conditions ~
>
    if (val1 && val2 || val3)
        body();

    if (val1
            && val2
            || val3)
        body();
<
Function calls ~
>
    myfunction(arg1, arg2, arg3, arg4);

    myfunction(arg1,
            arg2,
            arg3,
            arg4);
<
Lambda functions ~
>
    some_function(foo -> "bar");

    some_function(foo -> {
      return "bar";
    });
<

==============================================================================
JAVASCRIPT                                                *splitjoin-javascript*
                                                            *splitjoin-json*

Object and Array splitting also work for JSON, if it's set as a separate
filetype. (If it's just set to "javascript", it'll just apply javascript
logic). If the filetype is "json", trailing commas will automatically be
disabled, too.

Objects ~

Just like in ruby and python, the cursor needs to be inside the object in
order to split it.
>
    var one = {one: "two", three: "four"};

    var one = {
      one: "two",
      three: "four"
    };
<
Arrays ~
>
    var one = ['two', 'three', 'four'];

    var one = [
      'two',
      'three',
      'four'
    ];

Function Arguments ~
>
    var foo = bar('one', 'two', 'three');

    var foo = bar(
      'one',
      'two',
      'three'
    );
<
Functions ~

When the cursor is on the "function" keyword, the script attempts to split the
curly braces of the function. This is a bit more convenient for the common
use-case of one-line to multi-line functions.
>
    var callback = function (something, other) { something_else; };

    var callback = function (something, other) {
      something_else;
    };
<
One-line if conditionals ~
>
    if (isTrue()) {
      doSomething();
    }

    if (isTrue()) doSomething();
<
Fat-arrow functions ~
>
    some_function(foo => "bar");

    some_function(foo => {
      return "bar";
    });
<

==============================================================================
JSX                                                              *splitjoin-jsx*
                                                                 *splitjoin-tsx*

Both HTML and Javascript splitters and joiners work for JSX and TSX. There's
also one additional transformation:

Self-closing tags ~
>
    let button = <Button />;

    let button = <Button>
        </Button>;


Note that, in Vim, these languages are supported within the  `javascrptreact`
and `typescriptreact` filetypes, so if callbacks don't work right,
double-check the detected filetype of the buffer.

==============================================================================
LUA                                                              *splitjoin-lua*

For Lua, only splitting and joining functions is implemented at this point.
Note that joining a function attempts to connect the lines of the body by
using ";". This doesn't always work -- a few constructs are not syntactically
valid if joined in this way. Still, the idea is to inline small functions, so
it's assumed this is not a big issue.

Functions ~
>
    function example ()
      print("foo")
      print("bar")
    end

    function example () print("foo"); print("bar") end

    local something = other(function (one, two)
      print("foo")
    end)

    local something = other(function (one, two) print("foo") end)
<

==============================================================================
PERL                                                            *splitjoin-perl*

If/unless/while/until clauses ~

The variable |splitjoin_perl_brace_on_same_line| controls the format of the
curly braces when joining. If it's set to 0, the opening curly brace will be
on its own line. Otherwise, it'll be placed on the same line as the if-clause
(the default behaviour).
>
    print "a = $a\n" if $debug;

    if ($debug) {
      print "a = $a\n";
    }
<
And/or clauses ~

It only makes sense to split these -- joining results in joining an if/unless
clause. The variable |splitjoin_perl_brace_on_same_line| affects the results
as explained above.
>
    open PID, ">", $pidfile or die;

    unless (open PID, ">", $pidfile) {
      die;
    }
<
Hashes ~
>
    my $info = {name => $name, age => $age};

    my $info = {
      name => $name,
      age => $age,
    };
<
Lists ~
>
    my $var = ['one', 'two', 'three'];

    my $var = [
      'one',
      'two',
      'three'
    ];

    my @var = ('one', 'two', 'three');

    my @var = (
      'one',
      'two',
      'three'
    );
<
Word lists ~
>
    my @var = qw(one two three);

    my @var = qw(
      one
      two
      three
    );
<

==============================================================================
PHP                                                              *splitjoin-php*

Arrays ~
>
    foo = array('one' => 'two', 'two' => 'three')

    foo = array(
      'one' => 'two',
      'two' => 'three'
    )
<
Short arrays ~
>
    $one = ['two', 'three', 'four']

    $one = [
      'two',
      'three',
      'four'
    ]
<
If-clauses ~
>
    if ($foo) { $a = "bar"; }

    if ($foo) {
      $a = "bar";
    }
<
PHP markers ~
>
    <?php echo "OK"; ?>

    <?php
    echo "OK";
    ?>
<
Method calls~

Affects all the arrows after the cursor when |splitjoin_php_method_chain_full|
is set to 1. Otherwise, it affects only a single arrow (the default
behaviour).
>
    $var = $one->two->three()->four();

    $var = $one
        ->two->three()->four();

    # OR

    $var = $one
        ->two
        ->three()
        ->four();


==============================================================================
PYTHON                                                        *splitjoin-python*

Just like in ruby, the cursor needs to be inside the dict in order to split it
correctly, otherwise it tries to split it as a statement (which works, due to
the dict having ":" characters in it).

Dicts ~
>
    knights = {'gallahad': 'the pure', 'robin': 'the brave'}

    knights = {
            'gallahad': 'the pure',
            'robin': 'the brave'
            }
<
Lists ~
>
    spam = [1, 2, 3]

    spam = [1,
            2,
            3]
<
Tuples ~
>
    spam = (1, 2, 3)

    spam = (1,
            2,
            3)
<
List comprehensions ~
>
    result = [x * y for x in range(1, 10) for y in range(10, 20) if x != y]

    result = [x * y
              for x in range(1, 10)
              for y in range(10, 20)
              if x != y]
<
Statements ~
>
    if foo: bar()

    if foo:
        bar()
<
Imports ~
>
    from foo import bar, baz

    from foo import bar,\
            baz
    " or, depending on `g:splitjoin_python_import_style`:
    from foo import (
        bar,
        baz,
    )
<
Ternary assignment ~
>
    max_x = x1 if x1 > x2 else x2

    if x1 > x2:
        max_x = x1
    else:
        max_x = x2
<
Multiple assignment ~
>
    a, b = foo("bar"), [one, two, three]

    a = foo("bar")
    b = [one, two, three]

    un, pack = something

    un = something[0]
    pack = something[1]
<
Note that splitting `a, b = b, a` would not result in an expression that works
the same way, due to the special handling by python of this case to swap two
values.

Strings ~
>
    db.execute('UPDATE table SET value = ?', value)

    db.execute('''
        UPDATE table SET value = ?
    ''', value)
<
To avoid string-splitting overriding argument-splitting, it only triggers when
the cursor is on the string delimiter. It's recommended to use f'/f"/F'/F" to
position the cursor precisely before splitting.


==============================================================================
R                                                                  *splitjoin-r*

Function calls ~
>
    print(1, 2, 3)

    # with g:r_indent_align_args = 0
    print(
      1,
      2,
      3
    )

    # with g:r_indent_align_args = 1
    print(1,
          2,
          3)
<

==============================================================================
RUBY                                                            *splitjoin-ruby*

If/unless/while/until clauses ~

Joining works for more-than-one-line "if" clauses as well, but it doesn't look
very pretty. It's generally recommended to use it only when the body is a
single line.
>
    return "the answer" if 6 * 9 == 42

    if 6 * 9 == 42
      return "the answer"
    end
<
Hashes ~

To split a hash, you need to be within the curly brackets. Otherwise, the
plugin attempts to split it as a block.
>
    foo = { :bar => 'baz', :one => 'two' }

    foo = {
      :bar => 'baz',
      :one => 'two'
    }
<
Option hashes ~

There's an option, |splitjoin_ruby_curly_braces|, that controls whether the
curly braces are present after splitting or joining.
>
    foo 1, 2, :one => 1, :two => 2

    foo 1, 2, {
      :one => 1,
      :two => 2
    }

    # note that after joining, the result will be:

    foo 1, 2, { :one => 1, :two => 2 }
<
Method arguments ~

These only get split if there is no option hash at the end.

The variable |splitjoin_ruby_hanging_args| controls whether the arguments
will be left "hanging", aligned near the brackets, or if the brackets will be
put on their own lines.

Joining for the "hanging" style doesn't really work, since there's no easy,
reliable way to detect the continued arguments. However, a simple vanilla-vim
|J| should do the trick.
>
    params.permit(:title, :action, :subject_type, :subject_id, :own)

    params.permit(:title,
                  :action,
                  :subject_type,
                  :subject_id,
                  :own)

    # with splitjoin_ruby_hanging_args == 0

    params.permit(
      :title,
      :action,
      :subject_type,
      :subject_id,
      :own
    )
<
Caching constructs  ~
>
    @two ||= 1 + 1

    @two ||= begin
               1 + 1
             end
<
Blocks ~
>
    Bar.new { |b| puts b.to_s }

    Bar.new do |b|
      puts b.to_s
    end
<
Block &-shorthand ~
>
    [1, 2, 3].map(&:to_s)

    [1, 2, 3].map do |i|
      i.to_s
    end
<
Heredocs ~

You can change whether it splits into `<<`, `<<-`, or `<<~` by setting the
value of the |splitjoin_ruby_heredoc_type| setting (by default, it's `<<~`).
>
    string = 'something'

    string = <<~EOF
      something
    EOF
<
Ternaries ~
>
    if condition
      do_foo
    else
      do_bar
    end

    condition ? do_foo : do_bar
<
Cases ~

Splits or joins single when clauses, if the cursors sits on the line of
such a when, or the whole case, if you have or cursor in the line of the
case-keyword, as shown in the example.
>
    case condition
    when :a
      do_foo
    when :b
      do_bar
    else
      do_baz
    end

    case condition
    when :a then do_foo
    when :b then do_bar
    else do_baz
    end
>
Arrays ~
>
    list = ['one', 'two', 'three']

    list = [
      'one',
      'two',
      'three'
    ]
<
Array literals ~
>
    list = %w{one two three}

    list = %w{
      one
      two
      three
    }
<
Module namespacing ~

Note that splitting and joining module namespaces relies on the built-in
|matchit| plugin. Splitjoin will attempt to load it if it isn't loaded
already, but if that fails for some reason, this logic will silently not work.
>
    module Foo
      class Bar < Baz
        def qux
        end
      end
    end

    class Foo::Bar < Baz
      def qux
      end
    end
<
Module namespacing in RSpec tests ~

Same as above: uses the |matchit| plugin.
>
    module Foo
      RSpec.describe Bar do
        it "does stuff" do
        end
      end
    end

    RSpec.describe Foo::Bar do
      it "does stuff" do
      end
    end
<
Method continuations ~

For the moment, this only works in the direction of joining, since splitting
is too ambiguous (how to decide whether to split the method dot or the
function's arguments?).
>
    one.
      two.three(foo, bar)
    one
      .two.three(foo, bar)

    one.two.three(foo, bar)

Ruby 3.0 endless def ~
>
    def foo(one, two)
      bar
    end

    def foo(one, two) = bar
<

==============================================================================
RUST                                                          *splitjoin-rust*

Structs ~
>
    Scanner { source: String::new(), line: 1 }

    Scanner {
        source: String::new(),
        line: 1
    }
<
Function definitions, calls, and arrays ~
>
    fn function_call<T>(values: Vec<T>, s: &'static str) -> ();
    fn function_call<T>(
        values: Vec<T>,
        s: &'static str,
    ) -> ();

    function_call(Vec::<u32>::new(), &ref);
    function_call(
        Vec::<u32>::new(),
        &ref,
    );

    vec![one, two, three];
    vec![
        one,
        two,
        three,
    ];
<
Match clauses ~
>
    match one {
        Ok(two) => some_expression(three),
    }

    match one {
        Ok(two) => {
            some_expression(three)
        },
    }
<
Question mark operator ~

The plugin determines how to split a `?` by looking upwards for a `-> Result`
or `-> Option` . If it can't find anything when splitting, it'll default to a
`Result`. If it can't find anything when joining, it'll convert the match into
an `.unwrap()` instead.
>
    let file = File::open("foo.txt")?;

    let file = match File::open("foo.txt") {
        Ok(value) => value,
        Err(e) => return Err(e.into()),
    };

    let thing = Some(3)?;

    let thing = match Some(3) {
        None => return None,
        Some(value) => value,
    };
<
Closures ~
>
    function_call(|x| x.to_string(), y);

    function_call(|x| {
        x.to_string()
    }, y);
<
Unwrap/Expect match split ~

This one only splits for the moment. The cursor MUST be on `unwrap` in order
to get this effect, in this particular example.

The plugin attempts to find the end of the expression, and make a match
statement out of it. It also works with `expect` calls.
>
    let foo = Some::value(chain).of(things).unwrap();

    let foo = match Some::value(chain).of(things) {

    }
<
Empty matches and if-let ~
>
    if let Some(value) = iterator.next() {
        println!("do something with {}", value);
    }

    match iterator.next() {
        Some(value) =>  {
            println!("do something with {}", value);
        },
        _ => (),
    }
<
Import lists ~

With the cursor on the pre-curly bracket part of an import:
>
    use std::io::{Read, Write, Process};

    use std::io::Read;
    use std::io::Write;
    use std::io::Process;
<
Joining works downwards -- attempting to join the current line with as many as
possible below. It will look for the common part between the first two imports
and try to apply it on any later ones that match.

With the cursor in the curly brackets:
>
    use std::io::{Read, Write};

    use std::io::{
        Read,
        Write
    };
<

==============================================================================
SCSS                                                            *splitjoin-scss*
LESS                                                            *splitjoin-less*

Everything that works for CSS should work as well, and there's extra
functionality for the added nesting possibility.

Nested definitions ~

When splitting, the cursor position determines which part gets extracted into
a separate definition. Joining only works if there's only one child definition.
>
    ul li {
      a {
        padding: 10px;
      }
    }

    ul li a {
      padding: 10px;
    }
<

==============================================================================
SHELL                                                          *splitjoin-shell*

Support for shell scripts is quite basic -- splitting and joining by
semicolon. That's why it should be compatible with Bash, ZSH, etc. Activates
for the `sh` and `zsh` filetypes.
>
    echo "one"; echo "two"

    echo "one"
    echo "two"
<
If the line is not made up of semicolon-separated commands, it gets broken up
with a backslash at the cursor position, for example with the cursor on the
pipe:
>
    echo "one" | wc -c

    echo "one" \
        | wc -l
<
If there is a broken line like that, joining should always join it first,
before trying anything else.

==============================================================================
TEX                                                              *splitjoin-tex*

Begin-end blocks ~
>
    \begin{align*} x = y\\  y = z \end{align*}

    \begin{align*}
      x = y\\
      y = z
    \end{align*}
<
Enumerations ~
>
    \begin{enumerate} \item item1 \item item2 \end{enumerate}

    \begin{enumerate}
       \item item1
       \item item2
    \end{enumerate}
<

==============================================================================
VIMSCRIPT                                                  *splitjoin-vimscript*

Vimscript can generally be split anywhere by simply placing the remainder of
the line on the next one, prefixed by a backslash. That's why joining is
fairly easy to do for the most general case -- anything that is followed by a
line, starting with a backslash, can be joined with the current one.
>
    let example_one = {
        \ 'one': 'two',
        \ 'three': 'four'
        \ }

    " is joined (one line at a time) into:

    let example_one = { 'one': 'two', 'three': 'four' }

    command! Foo if one |
        \   'two'       |
        \ else          |
        \   'three'     |
        \ endif

    " is joined (one line at a time) into:

    command! Foo if one | 'two' | else | 'three' | endif
<
Splitting is a bit trickier, since anything can be split at any point. While
it's possible to handle some specific cases like dictionaries, arrays, and
commands, for now the plugin takes the simple approach of splitting precisely
where the cursor is right now. In the future, this may be replaced with
specific splits based on the context.


==============================================================================
YAML                                                            *splitjoin-yaml*

Arrays ~
>
    root:
      one: [1, 2]
      two: ['three', 'four']

    root:
      one:
        - 1
        - 2
      two:
        - 'three'
        - 'four'
<
Maps ~
>
    root:
      one: { foo: bar }
      two: { three: ['four', 'five'], six: seven }

    root:
      one:
        foo: bar
      two:
        three: ['four', 'five']
        six: seven
<

==============================================================================
SETTINGS                                                    *splitjoin-settings*

These are the variables that control the behaviour of the plugin.

Check the tags on the right side. The ones starting with `g:` are global
settings, while the ones starting with `b:` are buffer-local. The settings
that don't start with either of these two exist in both forms -- you can have
one global value for the setting and different buffer-local ones.


                                                   *b:splitjoin_split_callbacks*
                                                   *b:splitjoin_join_callbacks*
>
    let b:splitjoin_split_callbacks = [...]
    let b:splitjoin_join_callbacks = [...]
<
Default value: depends on the filetype

These two variables contain lists of functions that are called to execute the
splitting or joining functionality. If they are set to an empty array in a
particular file, this will effectively disable the plugin for it. You can look
through the source code of the plugin to see the functions that are currently
being executed for your filetype.

Example:
Putting the following in ftplugin/ruby.vim will disable the join functionality
for ruby files:
>
    let b:splitjoin_join_callbacks = []
<


                                                    *g:splitjoin_split_mapping*
                                                    *g:splitjoin_join_mapping*
>
    let g:splitjoin_split_mapping = 'cS'
    let g:splitjoin_join_mapping  = 'cJ'
<

Default values: 'gS' and 'gJ'

Changing these values changes the default mappings of the plugin. Note that,
if no splitting or joining can be performed, these default mappings will fall
back to performing the key sequence's built-in functionality.

Set to a blank string to disable default mappings completely. You can still
create your own mapping the old-fashioned way using the |:SplitjoinSplit| and
|:SplitjoinJoin| commands, though in the case with no possible
splitting/joining, nothing will happen.


                                                               *splitjoin_quiet*
>
    let g:splitjoin_quiet = 1
<
Default value: 0

The plugin will output a message, "Splitjoin: Working...", when splitting or
joining, which will be cleared when it's done. Ideally, this will only show up
for a fraction of a second, but with very large code blocks, there might be
work to do. A regrettable example is splitting a large ruby hash -- the plugin
itself doesn't do a lot of work, but indentation ends up rather slow in this
particular scenario.

In order to silence these messages, if you find them annoying, set this
variable to 1.

                                                    *splitjoin_mapping_fallback*
>
    let g:splitjoin_mapping_fallback = 0
<
Default value: 1

If the plugin doesn't split or join something, it'll execute the sequence of
keys normally. So, if joining is mapped to its default of `gJ` and there's
nothing valid to join, it'll execute the built-in |gJ|.

Setting this value to 0 will disable this behaviour.


                                            *splitjoin_disabled_split_callbacks*
>
    let g:splitjoin_disabled_split_callbacks = ['sj#html#SplitAttributes']
<
Default value: []

This setting allows you to disable a particular split type by adding its
function callback to the list. To find the specific name to disable, you'd
need to dig into the source code of the plugin in
`ftplugin/<filetype-name>/splitjoin.vim`. If you're not sure which callback
performs which split, try disabling them one by one until you've got the
behaviour you're looking for.

                                             *splitjoin_disabled_join_callbacks*
>
    let g:splitjoin_disabled_join_callbacks = ['sj#html#JoinAttributes']
<
Default value: []

This setting allows you to disable a particular join type by adding its
function callback to the list. To find the specific name to disable, you'd
need to dig into the source code of the plugin in
`ftplugin/<filetype-name>/splitjoin.vim`. If you're not sure which callback
performs which join, try disabling them one by one until you've got the
behaviour you're looking for.

                                                *splitjoin_normalize_whitespace*
>
    let g:splitjoin_normalize_whitespace = 0
<
Default value: 1

This variable controls whether duplicate whitespace should be reduced within a
joined structure, which makes a lot of sense in most situations, particularly
when the items are aligned. Set it to 0 to disable this behaviour.

Example:
When this setting is enabled, the extra whitespace around "=>" symbols in ruby
hashes is removed:
>
    one = {
      :one   => 'two',
      :three => 'four',
      :a     => 'b'
    }

    one = { :one => 'two', :three => 'four', :a => 'b' }
<

                                                               *splitjoin_align*
>
    let g:splitjoin_align = 1
<
Default value: 0

This is a flag that controls whether a few constructs should be aligned by a
certain character. As a specific example, when you split ruby hashes, this can
align them by the "=>" signs. In a way, |splitjoin_normalize_whitespace| is
a complement to this setting, since you'd probably want to reduce the extra
whitespace when joining.

Set the flag to 1 to attempt alignment. In order for it to work, it requires
that you have either Tabular (https://github.com/godlygeek/tabular) or Align
(http://www.vim.org/scripts/script.php?script_id=294) installed. If that's not
the case, the value of this setting will be ignored.

Example:
>
    one = { :one => 'two', :three => 'four', :a => 'b' }

    one = {
      :one   => 'two',
      :three => 'four',
      :a     => 'b'
    }
<

                                                 *splitjoin_curly_brace_padding*
>
    let g:splitjoin_curly_brace_padding = 0
<
Default value: 1

Controls whether joining things with curly braces will add a space between the
brackets and the joined body. So, setting it to 0 or 1 results in, respectively:
>
    import {one, two, three} from 'foo';
    import { one, two, three } from 'foo';
<


                                                      *splitjoin_trailing_comma*
>
    let g:splitjoin_trailing_comma = 1
<
Default value: 0

This adds a trailing comma when splitting lists of things. There is a
ruby-specific setting called |splitjoin_ruby_trailing_comma|, but it's
preferred to use this one. You can easily set it per-filetype by using the
buffer-local variable with the same name.

Example:
>
    one = { :one => 'two', :a => 'b' }

    one = {
      :one => 'two',
      :a => 'b',
    }
<

                                                   *splitjoin_ruby_curly_braces*
>
    let g:splitjoin_ruby_curly_braces = 0
<
Default value: 1

This flag controls the formatting of ruby option hashes when splitting.
When it's 1, curly braces will be present in option blocks. Example:
>
    User.new :one, :first_name => "Andrew", :last_name => "Radev"

    User.new :one, {
      :first_name => "Andrew",
      :last_name => "Radev"
    }
<
When the flag is 0, the result will be:
>
    User.new :one,
      :first_name => "Andrew",
      :last_name  => "Radev"
<
This won't always have effect. In some cases, it's not syntactically valid to
omit the curly braces, which is part of the reason I prefer having them
around. However, when there's a non-optional argument or the option hashes is
wrapped in round braces, it should work just fine.

Regardless of the value of this option, the second example will be joined back
to:
>
    User.new :one, :first_name => "Andrew", :last_name => "Radev"
<
That's because it's easy to infer that it's an option block. Unfortunately,
it's more difficult to decide whether we have an option block or a plain hash
if there are braces, so the first example will always be joined to:
>
    User.new :one, { :first_name => "Andrew", :last_name => "Radev" }
<

                                                 *splitjoin_ruby_trailing_comma*
>
    let g:splitjoin_ruby_trailing_comma = 1
<
Default value: 0

This controls whether to put a trailing comma on a split hash. With this set
to 1, a hash will split like so:
>
    User.new :one, :first_name => "Andrew", :last_name => "Radev"

    User.new :one, {
      :first_name => "Andrew",
      :last_name => "Radev",
    }
<
Note the trailing comma for the last element.

It's preferred to use the global option |splitjoin_trailing_comma|, and set the
buffer-local one for ruby to something different, if you'd like to.


                                                  *splitjoin_ruby_hanging_args*
>
    let g:splitjoin_ruby_hanging_args = 0
<
Default value: 1

This controls whether to split function arguments in the "hanging" style:
>
    params.permit(:title,
                  :action,
                  :subject)
<
If it is set to 0, the result will be:
>
    params.permit(
      :title,
      :action,
      :subject
    )
<

                                                *splitjoin_ruby_do_block_split*
>
    g:splitjoin_ruby_do_block_split
<
Default value: 1

This controls whether to convert split blocks to their do-form. It's set to
"1" by default, so block split like so:
>
    [1, 2, 3].map { |n| n ** 2 }

    [1, 2, 3].map do |n|
      n ** 2
    end
<
If it is set to 0, the result will be:
>
    [1, 2, 3].map { |n| n ** 2 }

    [1, 2, 3].map { |n|
      n ** 2
    }
<

                                           *splitjoin_ruby_options_as_arguments*
>
    let g:splitjoin_ruby_options_as_arguments = 1
<
Default value: 0

If set to 1, this will split options along with arguments, except if the
cursor is on one of the options.

Ordinarily, splitting function arguments will always split options, if there
are any, and only split positional arguments, if there are no options. Like in
this example:
>
    User.new(:one, :two, first_name: "Andrew", last_name: "Radev")

    User.new(:one, :two,
             first_name: "Andrew",
             last_name: "Radev")
<
With this option set to 1, the plugin will split BOTH arguments and options,
if the cursor is on the arguments, and it will split ONLY options if the
cursor is on the options.

So, with the cursor on "two":
>
    User.new(:one,
             :two,
             first_name: "Andrew",
             last_name: "Radev")
<
But with the cursor on "first_name", you'll still get:
>
    User.new(:one, :two,
             first_name: "Andrew",
             last_name: "Radev")
<
The output varies according to other settings as well, like curly brackets.


                                       *splitjoin_ruby_expand_options_in_arrays*
>
    let g:splitjoin_ruby_expand_options_in_arrays = 1
<
Default value: 0

If set to 1, then the last hash of an array will be expanded to "options". For
example:
>
    array = [one, two, { three: four, five: six }]
    array = [
      one,
      two,
      three: four,
      five: six,
    ]
<

                                             *splitjoin_coffee_suffix_if_clause*
>
    let g:splitjoin_coffee_suffix_if_clause = 0
<

Default value: 1

This flag controls the kind of if-clause to use when joining multiline
if-clauses in coffeescript. Given the following example:
>
    if foo?
      console.log bar
<
Joining this construct with |splitjoin_coffee_suffix_if_clause| set to 1 (the
default) would produce:
>
    console.log bar if foo?
<
Doing that with |splitjoin_coffee_suffix_if_clause| set to 0 would result in:
>
    if foo? then console.log bar
<

                                             *splitjoin_perl_brace_on_same_line*
>
    let g:splitjoin_perl_brace_on_same_line = 0
<
Default value: 1

This flag controls the placement of curly braces when joining if-clauses. When
it's 1 (the default), the opening brace will be placed on the same line:
>
    if ($debug) {
      print "a = $a\n";
    }
<
If it's set to 0, the brace will get its own line:
>
    if ($debug)
    {
      print "a = $a\n";
    }
<

                                                   *splitjoin_ruby_heredoc_type*
>
    let g:splitjoin_ruby_heredoc_type = '<<-'
<
Default value: "<<~"

This setting can be one of "<<-", "<<~", and "<<" and controls how strings
will be split into heredocs. If it's "<<-", the following form is used
>
    do
      foo = <<-EOF
      something
      EOF
    end
<
If it's set to "<<", the result is this:
>
    do
      foo = <<EOF
    something
    EOF
    end
<
With "<<~" (the default), you'll get:
>
    do
      foo = <<~EOF
        something
      EOF
    end
<

                                   *splitjoin_python_brackets_on_separate_lines*
>
    let g:splitjoin_python_brackets_on_separate_lines = 1
<
Default value: 0

If set to 1, then python will split lists and tuples so that the opening and
closing bracket are placed on separate lines. If it's 0, the first argument
will remain where it is, and the rest will be split on separate lines.

Example:
>
    # let g:splitjoin_python_brackets_on_separate_lines = 1
    some_method(
            one,
            two
            )

    # let g:splitjoin_python_brackets_on_separate_lines = 0
    some_method(one,
            two)
<
The first example might look a bit odd, but if you have the python-pep8-indent
plugin (https://github.com/hynek/vim-python-pep8-indent), it should look quite
reasonable.


                                                 *splitjoin_python_import_style*
>
    let g:splitjoin_python_import_style = 'round_brackets'
<
Default value: 'newline_escape'

The default splitting for python imports is to add line escapes after the
commas. I have no idea why I originally implemented it like this, but it seems
perfectly acceptable to just surround the imports in round brackets. Example:
>
    " Style: 'newline_escape':
    from foo import bar,\
            baz

    " Style: 'round_brackets':
    from foo import (
        bar,
        baz,
    )
<
The default is "newline_escape" since it's been this way for a long time.


                             *splitjoin_handlebars_closing_bracket_on_same_line*
>
    let g:splitjoin_handlebars_closing_bracket_on_same_line = 1
<
Default value: 0

If set to 1, then handlebars will keep the closing "}}" on the same line as
the last line of the component. At the time of writing, this isn't indented
very well, but it might be improved in the future.

If it's 0, the closing "}}" will be placed on its own line.


                                        *splitjoin_handlebars_hanging_arguments*
>
    let g:splitjoin_handlebars_hanging_arguments = 1
<
Default value: 0

If set to 1, then handlebars will keep one argument on the first line when
splitting, so the component will look "hanging". With the closing bracket on
the same line, as above, and the right indentation plugin, it might look like
this:
>
    {{foo-bar one="two"
              three="four"}}
<
If it's 0, the default, all parameters will be on their own line:
>
    {{foo-bar
      one="two"
      three="four"}}
<

                                 *splitjoin_html_attributes_bracket_on_new_line*
>
    let g:splitjoin_html_attributes_bracket_on_new_line = 1
<
Default value: 0

If set to 1, then splitting HTML attributes will put the closing angle bracket
on a new line on its own, like this:
>
    <div
      class="whatever"
      >
      text
    </div>
<
When set to 0, as is the default, it will look like this:
>
    <div
      class="whatever">
      text
    </div>
<
                                             *splitjoin_html_attributes_hanging*
>
    let g:splitjoin_html_attributes_hanging = 1
<
Default value: 0

If set to 1, then splitting HTML attributes will keep the first attribute on
the same line, and split the rest. Combined with indentation support, it
should look like this:
>
    <button class="button control"
            @click="save"
            v-if="admin">
      Save
    </button>
<
When set to 0, as is the default, it will look like this:
>
    <button
      class="button control"
      @click="save"
      v-if="admin">
      Save
    </button>
<

                                               *splitjoin_php_method_chain_full*
>
    let g:splitjoin_php_method_chain_full = 1
<
Default value: 0

If set to 1, then splitting a method chain will split all the arrows after the
cursor.
>
    $var = $foo->one()->two()->three();

Splitting on "->two" if set to 0:
>
    $var = $foo->one()
        ->two()->three();

If set to 1:
>
    $var = $foo->one()
        ->two()
        ->three();

Joining a chain will also join all the methods calls.

                                   *splitjoin_java_argument_split_first_newline*
                                    *splitjoin_java_argument_split_last_newline*
>
    let g:splitjoin_java_argument_split_first_newline = 1
    let g:splitjoin_java_argument_split_last_newline  = 1
<
Default value: 0

These variables control whether a newline will be placed between the bracket
and the first or last item of a java argument list when splitting. With the
default, both set to 0, a split might look like this:
>
    functionCall(one,
            two,
            three)
<
With both values set to 1, a space will be left before the first item and
after the last one:
>
    functionCall(
            one,
            two,
            three
            )
<
This is a setting that might be generalized for other languages and constructs
at a later time.

                                   *splitjoin_c_argument_split_first_newline*
                                    *splitjoin_c_argument_split_last_newline*
>
    let g:splitjoin_c_argument_split_first_newline = 1
    let g:splitjoin_c_argument_split_last_newline  = 1
<
Default value: 0

Same like the arguments for java.

                                *splitjoin_vim_split_whitespace_after_backslash*
>
    let g:splitjoin_vim_split_whitespace_after_backslash = 0
<
Default value: 1

Whether to leave a single space after the `\` of a line break. In many cases,
when breaking a line, one space is left between the backslash and the line
part. However, if it's broken at a `.`, it could cause parsing problems. Not
leaving a space might be safer, set to 0 to do that.


                                                     *splitjoin_fasta_textwidth*
>
    let g:splitjoin_fasta_textwidth = 100
<
Default value: 0

Fasta files get split into lines based on textwidth. If this variable is set
to anything greater than 0, that will be considered the desired textwidth.
Otherwise, the built-in 'textwidth' will be used. If that's set to 0, the
plugin will arbitrarily use 100 as the threshold.


==============================================================================
INTERNALS                                                *splitjoin-internals*

The only interface of the plugin is in 'plugin/splitjoin.vim'. It's a fairly
short file containing two commands, |:SplitjoinSplit| and |:SplitjoinJoin|.  All
of the actual splitting and joining logic is in autoloaded files. The only
things that these two commands do are:

- Check the |b:splitjoin_join_callbacks| and |b:splitjoin_split_callbacks|
  respectively for a list of function names.
- Invoke the functions, in order. If any of the functions returns a number
  different than 0, stop.

The actual functions may do whatever they want, but it makes sense for them to
return 0 only if they haven't made any modifications to the buffer.

The function names could be buffer-local, global, autoloaded, anything the
|function()| call can use.

Obviously, extending the plugin is straightforward -- it's enough to define a
function for splitting and one for joining and add those to the buffer
variable. Of course, that doesn't imply it's easy -- the functions would need
to actually perform all the necessary manipulations and simply inform the
plugin if they've been successful by returning a number other than 0 as a
result.

The file 'autoload/sj.vim' contains helpers that might be useful for said
manipulations. There are functions for replacing bodies of text defined by
normal mode motions or by line ranges, for saving and restoring the cursor
position and possibly other interesting functions that might assist. They
should be commented reasonably well.

The other files in 'autoload/sj' might be useful as well, although they're
mostly filetype-specific.

The files in 'autoload/sj/argparser' contain small parsers for parts of a few
of the languages that are supported. They're necessary for splitting
dictionary objects, since those can have a lot of structure and usually can't
be analyzed properly with just regular expressions.

==============================================================================
ISSUES                                                      *splitjoin-issues*

- If |g:splitjoin_align| is truthy and the Align plugin is being used, the
  "undo" action undoes only the alignment first, then the splitting.
- Joining ruby option hashes could result in a pair of unnecessary curly
  braces.

Any other issues and suggestions are very welcome on the github bugtracker:
https://github.com/AndrewRadev/splitjoin.vim/issues


vim:tw=78:sw=4:ft=help:norl: